Product details for  ARP1 actin-related protein 1 homolog B, centractin beta (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

Overview

Antigen: ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B)
Antibody Type: Monoclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN168267
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

back to top ^


Antigen ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B)
Gene ID 10120
Immunogen ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPD GSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description ARP1 actin-related protein 1 homolog B, centractin beta (yeast) This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex. Mouse monoclonal antibody raised against a partial recombinant ACTR1B. Synonyms: ARP1B, CTRN2
Clone 40000000000
Host Mouse

Application Details:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 1x PBS, pH 7.2
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

External Information:  ARP1 actin-related protein 1 homolog B, centractin beta (yeast) (ACTR1B) (Human) antibody

back to top ^


Google Scholar Find more references for clone 40000000000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ACTR1B (Bioinformatic Harvester (EMBL))