Product details for  B-cell CLL/lymphoma 6, member B (zinc finger protein) (BC...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody

Overview

Image for B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody
Antigen: B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN173236
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody

back to top ^


Antigen B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B)
Gene ID 255877
Immunogen BCL6B (NP_862827, 248 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GPIPGPQSRLSPTAATVQFKCGAPASTPYLLTSQAQDTSGSPSERARPLPGSEFF SCQNCEAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLA*
Reactivity Human
Antibody Type Polyclonal
Description B-cell CLL/lymphoma 6, member B (zinc finger protein) Mouse polyclonal antibody raised against a partial recombinant BCL6B. Synonyms: BAZF, ZBTB28, ZNF62
Host Mouse

Application Details:  B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.89 KDa) .

Image for B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody (1)

External Information:  B-cell CLL/lymphoma 6, member B (zinc finger protein) (BCL6B) (Human) antibody

back to top ^


Google Scholar Find more references for antigen BCL6B on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen BCL6B (Bioinformatic Harvester (EMBL))