B-cell CLL/lymphoma 7C (BCL7C) (Human) antibody

Overview


	Antigen:	B-cell CLL/lymphoma 7C (BCL7C)
	Antibody Type:	Monoclonal
	Application:	ELISA, Western Blotting (WB)
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN168058
	Availability:	Delivery in 7 to 10 days

Antigen	B-cell CLL/lymphoma 7C (BCL7C)
Gene ID	9274
Immunogen	BCL7C (NP_004756, 86 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQP PRLGQERDPGGITAGSTDEPPMLT*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	B-cell CLL/lymphoma 7C This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. Mouse monoclonal antibody raised against a partial recombinant BCL7C.
Clone	5F1
Host	Mouse

Application	ELISA, Western Blotting (WB)
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.80 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (34.80 KDa) .

Image for B-cell CLL/lymphoma 7C (BCL7C) (Human) antibody (1)

The detection limit for recombinant GST tagged BCL7C is approximately 0.1ng/ml as a capture antibody.

Image for B-cell CLL/lymphoma 7C (BCL7C) (Human) antibody (2)

Google Scholar	Find more references for clone 5F1 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen BCL7C (Bioinformatic Harvester (EMBL))