BASKET
HELP
Product details for D-amino-acid oxidase (DAO) (Human) antibody
D-amino-acid oxidase (DAO) (Human) antibody
Overview
|
|
| Antigen: | D-amino-acid oxidase (DAO) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN170095 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: D-amino-acid oxidase (DAO) (Human) antibody
| Antigen | D-amino-acid oxidase (DAO) |
| Gene ID | 1610 |
| Immunogen | DAO (NP_001908, 119 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PRELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVARE GADVIVNCTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHD* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | D-amino-acid oxidase This gene encodes the peroxisomal enzyme D-amino acid oxidase. The enzyme is a flavoprotein which uses flavin adenine dinucleotide (FAD) as its prosthetic group. Its substrates include a wide variety of D-amino acids, but it is inactive on the naturally occurring L-amino acids. Its biological function is not known, it has been suggested that it is involved in acid-base balance in the kidney, or it may be a fossil enzyme without a current function. Mouse polyclonal antibody raised against a partial recombinant DAO. Synonyms: DAAO, DAMOX, MGC35381, OXDA |
| Host | Mouse |
Application Details: D-amino-acid oxidase (DAO) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: D-amino-acid oxidase (DAO) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
External Information: D-amino-acid oxidase (DAO) (Human) antibody
| Google Scholar | Find more references for antigen DAO on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen DAO (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
