Product details for  D-aspartate oxidase (DDO) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

D-aspartate oxidase (DDO) (Human) antibody

Overview

Image for D-aspartate oxidase (DDO) (Human) antibody
Antigen: D-aspartate oxidase (DDO)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN171555
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  D-aspartate oxidase (DDO) (Human) antibody

back to top ^


Antigen D-aspartate oxidase (DDO)
Gene ID 8528
Immunogen DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQ RLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL*
Reactivity Human
Antibody Type Polyclonal
Description D-aspartate oxidase Mouse polyclonal antibody raised against a partial recombinant DDO. Synonyms: DASOX, DDO-1, DDO-2, FLJ45203
Host Mouse

Application Details:  D-aspartate oxidase (DDO) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  D-aspartate oxidase (DDO) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for D-aspartate oxidase (DDO) (Human) antibody (1)

External Information:  D-aspartate oxidase (DDO) (Human) antibody

back to top ^


Google Scholar Find more references for antigen DDO on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DDO (Bioinformatic Harvester (EMBL))