You are here: Homepage » Product details for "DAZ associated protein 2 DAZAP2 Human"

Product details for DAZ associated protein 2 (DAZAP2) (Human) antibody

Print Version

DAZ associated protein 2 (DAZAP2) (Human) antibody

Overview


	Antigen:	DAZ associated protein 2 (DAZAP2)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN171823
	Availability:	Delivery in 7 to 10 days

Antigen	DAZ associated protein 2 (DAZAP2)
Gene ID	9802
Immunogen	DAZAP2 (NP_055579, 93 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANV LVTQRKGNFFMGGSDGGYTIW*
Reactivity	Human
Antibody Type	Polyclonal
Description	DAZ associated protein 2 In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region and is deleted in many azoospermic and severely oligospermic men. It is thought that the Y chromosomal DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Mouse polyclonal antibody raised against a partial recombinant DAZAP2. Synonyms: KIAA0058, MGC14319, MGC766
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (34.47 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (34.47 KDa) .

Image for DAZ associated protein 2 (DAZAP2) (Human) antibody (1)

Google Scholar	Find more references for antigen DAZAP2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen DAZAP2 (Bioinformatic Harvester (EMBL))