You are here: Homepage » Product details for "DAZ interacting protein 1 DZIP1 Human"

Product details for DAZ interacting protein 1 (DZIP1) (Human) antibody

Print Version

DAZ interacting protein 1 (DZIP1) (Human) antibody

Overview


	Antigen:	DAZ interacting protein 1 (DZIP1)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN172194
	Availability:	Delivery in 7 to 10 days

Antigen	DAZ interacting protein 1 (DZIP1)
Gene ID	22873
Immunogen	DZIP1 (NP_945319, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSH IEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI *
Reactivity	Human
Antibody Type	Polyclonal
Description	DAZ interacting protein 1 Mouse polyclonal antibody raised against a partial recombinant DZIP1. Synonyms: DZIP, DZIPt1, KIAA0996, RP11-23E3.3
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (38.21 KDa) .

Image for DAZ interacting protein 1 (DZIP1) (Human) antibody (1)

Google Scholar	Find more references for antigen DZIP1 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen DZIP1 (Bioinformatic Harvester (EMBL))