Product details for  Defensin, beta-2 (a.a. 4-41) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

Defensin, beta-2 (a.a. 4-41) (Human) antibody

Overview

Antigen: Defensin, beta-2 (a.a. 4-41)
Antibody Type: Monoclonal
Application: Enzyme Immunometric Assay (EIA)
Reactivity: Human
Host: Mouse
Quantity: 10ug (1mg/ml (prior to lyophilizatio...)
Price: 261,00 €   (Plus shipping costs and VAT)
Order number: ABIN234970
Availability: 7-14 Business Days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  Defensin, beta-2 (a.a. 4-41) (Human) antibody

back to top ^


Antigen Defensin, beta-2 (a.a. 4-41)
Immunogen Synthetic human beta-Defensin 2 (a.a. 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Reactivity Human
Antibody Type Monoclonal
Format Purified, Lyophilized
Isotype IgG1 »Matching secondary antibodies
Description MAb to beta-Defensin-2 (a.a. 4-41) Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41) Cell culture supernatant
Clone L12-4C-C2
Host Mouse
Specificity Synthetic human beta-Defensin 2 (a.a. 4-41)

Application Details:  Defensin, beta-2 (a.a. 4-41) (Human) antibody

back to top ^


Application Enzyme Immunometric Assay (EIA)
Application Notes Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded. Reconstitution: Reconstitute in 10ul double distilled water.
Concentration 1mg/ml (prior to lyophilization)
Purification Protein L chromatography
Buffer Lyophilized from 50mM Tris, pH 7.4 Preservative: None
Restrictions For Research Use Only

External Information:  Defensin, beta-2 (a.a. 4-41) (Human) antibody

back to top ^


Google Scholar Find more references for clone L12-4C-C2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen Defensin, beta-2 (a.a. 4-41) (Bioinformatic Harvester (EMBL))