BASKET
HELP
Product details for E2F transcription factor 4, p107/p130-binding (E2F4) (Hum...
E2F transcription factor 4, p107/p130-binding (E2F4) (Human) antibody
Overview
|
|
| Antigen: | E2F transcription factor 4, p107/p130-binding (E2F4) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN166105 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: E2F transcription factor 4, p107/p130-binding (E2F4) (Human) antibody
| Antigen | E2F transcription factor 4, p107/p130-binding (E2F4) |
| Gene ID | 1874 |
| Immunogen | E2F4 (NP_001941, 211 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPA AEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | E2F transcription factor 4, p107/p130-binding The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. Mouse monoclonal antibody raised against a partial recombinant E2F4. Synonyms: E2F-4 |
| Clone | 5B7 |
| Host | Mouse |
Application Details: E2F transcription factor 4, p107/p130-binding (E2F4) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.01 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: E2F transcription factor 4, p107/p130-binding (E2F4) (Human) antibody
|
Western Blot detection against Immunogen (36.01 KDa) .
The detection limit for recombinant GST tagged E2F4 is approximately 0.03ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
