BASKET
HELP
Product details for E3 ubiquitin protein ligase, HECT domain containing, 1 (E...
E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) (Human) antibody
Overview
| Antigen: | E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) |
| Antibody Type: | Polyclonal |
| Application: | ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172522 |
| Availability: | Delivery in 7 to 10 days |
Customer Service
Additional Information: E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) (Human) antibody
| Antigen | E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) |
| Gene ID | 51366 |
| Immunogen | EDD1 (NP_056986, 2677 a.a. ~ 2775 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLVY FWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYV* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | E3 ubiquitin protein ligase, HECT domain containing, 1 This gene encodes a progestin-induced protein, which belongs to the HECT (homology to E6-AP carboxyl terminus) family. The HECT family proteins function as E3 ubiquitin-protein ligases, targeting specific proteins for ubiquitin-mediated proteolysis. This gene is localized to chromosome 8q22 which is disrupted in a variety of cancers. This gene potentially has a role in regulation of cell proliferation or differentiation. Mouse polyclonal antibody raised against a partial recombinant EDD1. Synonyms: DD5, EDD, HYD, KIAA0896, MGC57263 |
| Host | Mouse |
Application Details: E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) (Human) antibody
| Application | ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 50% Glycerol |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
External Information: E3 ubiquitin protein ligase, HECT domain containing, 1 (EDD1) (Human) antibody
| Google Scholar | Find more references for antigen EDD1 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen EDD1 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
