Product details for  ELAV (embryonic lethal, abnormal vision, Drosophila)-like...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody

Overview

Image for ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody
Antigen: ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166133
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody

back to top ^


Antigen ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1)
Gene ID 1994
Immunogen ELAVL1 (AAH03376, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDK VAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSS*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) The protein encoded by this gene is a member of the ELAVL protein family. This encoded protein contains 3 RNA-binding domains and binds cis-acting AU-rich elements. It destabilizes mRNAs and thereby regulates gene expression. Mouse monoclonal antibody raised against a partial recombinant ELAVL1. Synonyms: ELAV1, HUR, Hua, MelG
Clone 4G8
Host Mouse

Application Details:  ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody (1)

External Information:  ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) (ELAVL1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 4G8 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ELAVL1 (Bioinformatic Harvester (EMBL))