You are here: Homepage » Product details for "Fbox and WD40 domain protein 4 FBXW4 Human"

Product details for F-box and WD-40 domain protein 4 (FBXW4) (Human) antibody

Print Version

F-box and WD-40 domain protein 4 (FBXW4) (Human) antibody

Overview


	Antigen:	F-box and WD-40 domain protein 4 (FBXW4)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN171165
	Availability:	Delivery in 7 to 10 days

Antigen	F-box and WD-40 domain protein 4 (FBXW4)
Gene ID	6468
Immunogen	FBXW4 (NP_071322, 41 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SYLDMRALGRLAQVCRWLRRFTSCDLLWRRIARASLNSGFTRLGTDLMTSVPVKE RVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL*
Reactivity	Human
Antibody Type	Polyclonal
Description	F-box and WD-40 domain protein 4 This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds, disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22. Mouse polyclonal antibody raised against a partial recombinant FBXW4. Synonyms: DAC, FBW4, FBWD4, SHFM3, SHSF3
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for F-box and WD-40 domain protein 4 (FBXW4) (Human) antibody (1)

Google Scholar	Find more references for antigen FBXW4 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen FBXW4 (Bioinformatic Harvester (EMBL))