You are here: Homepage » Product details for "Fbox and WD40 domain protein 8 FBXW8 Human"

Product details for F-box and WD-40 domain protein 8 (FBXW8) (Human) antibody

Print Version

F-box and WD-40 domain protein 8 (FBXW8) (Human) antibody

Overview


	Antigen:	F-box and WD-40 domain protein 8 (FBXW8)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN172356
	Availability:	Delivery in 7 to 10 days

Antigen	F-box and WD-40 domain protein 8 (FBXW8)
Gene ID	26259
Immunogen	FBXW8 (NP_699179, 499 a.a. ~ 599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR GLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV*
Reactivity	Human
Antibody Type	Polyclonal
Description	F-box and WD-40 domain protein 8 This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Mouse polyclonal antibody raised against a partial recombinant FBXW8. Synonyms: FBW6, FBW8, FBX29, FBXO29, MGC33534
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for F-box and WD-40 domain protein 8 (FBXW8) (Human) antibody (1)

Google Scholar	Find more references for antigen FBXW8 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen FBXW8 (Bioinformatic Harvester (EMBL))