Product details for  F-box and leucine-rich repeat protein 4 (FBXL4) (Human) a...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody

Overview

Image for F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody
Antigen: F-box and leucine-rich repeat protein 4 (FBXL4)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172354
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody

back to top ^


Antigen F-box and leucine-rich repeat protein 4 (FBXL4)
Gene ID 26235
Immunogen FBXL4 (NP_036292, 524 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLR KLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSF*
Reactivity Human
Antibody Type Polyclonal
Description F-box and leucine-rich repeat protein 4 This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains at least 9 tandem leucine-rich repeats. Mouse polyclonal antibody raised against a partial recombinant FBXL4. Synonyms: FBL4, FBL5
Host Mouse

Application Details:  F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.67 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.67 KDa) .

Image for F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody (1)

External Information:  F-box and leucine-rich repeat protein 4 (FBXL4) (Human) antibody

back to top ^


Google Scholar Find more references for antigen FBXL4 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen FBXL4 (Bioinformatic Harvester (EMBL))