Product details for  F-box protein 16 (FBXO16) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

F-box protein 16 (FBXO16) (Human) antibody

Overview

Image for F-box protein 16 (FBXO16) (Human) antibody
Antigen: F-box protein 16 (FBXO16)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN173180
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  F-box protein 16 (FBXO16) (Human) antibody

back to top ^


Antigen F-box protein 16 (FBXO16)
Gene ID 157574
Immunogen FBXO16 (NP_758954, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRR RILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYI*
Reactivity Human
Antibody Type Polyclonal
Description F-box protein 16 This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Mouse polyclonal antibody raised against a partial recombinant FBXO16. Synonyms: FBX16, MGC125923, MGC125924, MGC125925
Host Mouse

Application Details:  F-box protein 16 (FBXO16) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  F-box protein 16 (FBXO16) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for F-box protein 16 (FBXO16) (Human) antibody (1)

External Information:  F-box protein 16 (FBXO16) (Human) antibody

back to top ^


Google Scholar Find more references for antigen FBXO16 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen FBXO16 (Bioinformatic Harvester (EMBL))