Product details for F-box protein 33 (FBXO33) (Human) antibody
F-box protein 33 (FBXO33) (Human) antibody
Overview
|
|
| Antigen: | F-box protein 33 (FBXO33) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN173232 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: F-box protein 33 (FBXO33) (Human) antibody
| Antigen | F-box protein 33 (FBXO33) |
| Gene ID | 254170 |
| Immunogen | FBXO33 (NP_976046, 197 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RNNRNLQKFSLFGDISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQ LKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTL* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | F-box protein 33 Members of the F-box protein family, such as FBXO33, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004). Mouse polyclonal antibody raised against a partial recombinant FBXO33. Synonyms: Fbx33, c14_5247 |
| Host | Mouse |
Application Details: F-box protein 33 (FBXO33) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: F-box protein 33 (FBXO33) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
External Information: F-box protein 33 (FBXO33) (Human) antibody
| Google Scholar | Find more references for antigen FBXO33 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen FBXO33 (Bioinformatic Harvester (EMBL)) |








