Product details for  F-box protein 34 (FBXO34) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

F-box protein 34 (FBXO34) (Human) antibody

Overview

Image for F-box protein 34 (FBXO34) (Human) antibody
Antigen: F-box protein 34 (FBXO34)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN172627
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  F-box protein 34 (FBXO34) (Human) antibody

back to top ^


Antigen F-box protein 34 (FBXO34)
Gene ID 55030
Immunogen FBXO34 (NP_060413, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGK ASSRKPFGILSPNVLCSMSGKSPVESSLNVKTKKNAPSATIHQGE*
Reactivity Human
Antibody Type Polyclonal
Description F-box protein 34 Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1, MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004). Mouse polyclonal antibody raised against a partial recombinant FBXO34. Synonyms: CGI-301, DKFZp547C162, FLJ20725, Fbx34, MGC126434, MGC126435
Host Mouse

Application Details:  F-box protein 34 (FBXO34) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  F-box protein 34 (FBXO34) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for F-box protein 34 (FBXO34) (Human) antibody (1)

External Information:  F-box protein 34 (FBXO34) (Human) antibody

back to top ^


Google Scholar Find more references for antigen FBXO34 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen FBXO34 (Bioinformatic Harvester (EMBL))