BASKET
HELP
Product details for F-box protein 7 (FBXO7) (Human) antibody
F-box protein 7 (FBXO7) (Human) antibody
Overview
|
|
| Antigen: | F-box protein 7 (FBXO7) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN168686 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: F-box protein 7 (FBXO7) (Human) antibody
| Antigen | F-box protein 7 (FBXO7) |
| Gene ID | 25793 |
| Immunogen | FBXO7 (NP_036311, 357 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRF VMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | F-box protein 7 This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined. Mouse monoclonal antibody raised against a partial recombinant FBXO7. Synonyms: DKFZp686B08113, FBX, FBX07, FBX7 |
| Clone | 4G8 |
| Host | Mouse |
Application Details: F-box protein 7 (FBXO7) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: F-box protein 7 (FBXO7) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) . |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
