BASKET
HELP
Product details for F-box protein 9 (FBXO9) (Human) antibody
F-box protein 9 (FBXO9) (Human) antibody
Overview
|
|
| Antigen: | F-box protein 9 (FBXO9) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172359 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: F-box protein 9 (FBXO9) (Human) antibody
| Antigen | F-box protein 9 (FBXO9) |
| Gene ID | 26268 |
| Immunogen | FBXO9 (NP_036479, 338 a.a. ~ 448 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSS GHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | F-box protein 9 This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates at least 3 transcript variants diverging at the 5' terminus. Mouse polyclonal antibody raised against a partial recombinant FBXO9. Synonyms: DKFZp434C0118, FBX9, KIAA0936, NY-REN-57, VCIA1, dJ341E18.2 |
| Host | Mouse |
Application Details: F-box protein 9 (FBXO9) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: F-box protein 9 (FBXO9) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: F-box protein 9 (FBXO9) (Human) antibody
| Google Scholar | Find more references for antigen FBXO9 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen FBXO9 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
