Product details for FLJ44691 protein (FLJ44691) (Human) antibody
FLJ44691 protein (FLJ44691) (Human) antibody
Overview
|
|
| Antigen: | FLJ44691 protein (FLJ44691) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 350,75 $ (Plus shipping costs , $13.59 dry ice fee and VAT, Invoice in EUR) |
| Order number: | ABIN173264 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: FLJ44691 protein (FLJ44691) (Human) antibody
| Antigen | FLJ44691 protein (FLJ44691) |
| Gene ID | 345193 |
| Immunogen | FLJ44691 (NP_940908, 422 a.a. ~ 497 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSR SSVESQVTFKSEGSRPEYYC* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | FLJ44691 protein Mouse polyclonal antibody raised against a partial recombinant FLJ44691. Synonyms: MGC120618 |
| Host | Mouse |
Application Details: FLJ44691 protein (FLJ44691) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (34.36 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: FLJ44691 protein (FLJ44691) (Human) antibody
|
Western Blot detection against Immunogen (34.36 KDa) . |
External Information: FLJ44691 protein (FLJ44691) (Human) antibody
| Google Scholar | Find more references for antigen FLJ44691 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen FLJ44691 (Bioinformatic Harvester (EMBL)) |








