Product details for  G protein pathway suppressor 1 (GPS1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

G protein pathway suppressor 1 (GPS1) (Human) antibody

Overview

Image for G protein pathway suppressor 1 (GPS1) (Human) antibody
Antigen: G protein pathway suppressor 1 (GPS1)
Antibody Type: Monoclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN166393
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  G protein pathway suppressor 1 (GPS1) (Human) antibody

back to top ^


Antigen G protein pathway suppressor 1 (GPS1)
Gene ID 2873
Immunogen GPS1 (AAH00155, 390 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGK EFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b kappa »Matching secondary antibodies
Description G protein pathway suppressor 1 This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant GPS1. Synonyms: COPS1, CSN1, MGC71287
Clone 100000000
Host Mouse

Application Details:  G protein pathway suppressor 1 (GPS1) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 1x PBS, pH 7.2
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  G protein pathway suppressor 1 (GPS1) (Human) antibody

back to top ^


The detection limit for recombinant GST tagged GPS1 is approximately 1ng/ml as a capture antibody.

Image for G protein pathway suppressor 1 (GPS1) (Human) antibody (1)

External Information:  G protein pathway suppressor 1 (GPS1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 100000000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen GPS1 (Bioinformatic Harvester (EMBL))