You are here: Homepage » Product details for "G proteincoupled receptor 56 GPR56 Human"

Product details for G protein-coupled receptor 56 (GPR56) (Human) antibody

Print Version

G protein-coupled receptor 56 (GPR56) (Human) antibody

Overview


	Antigen:	G protein-coupled receptor 56 (GPR56)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN171721
	Availability:	Delivery in 7 to 10 days

Antigen	G protein-coupled receptor 56 (GPR56)
Gene ID	9289
Immunogen	GPR56 (-, 31 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPR GLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLA*
Reactivity	Human
Antibody Type	Polyclonal
Description	G protein-coupled receptor 56 Mouse polyclonal antibody raised against a partial recombinant GPR56. Synonyms: BFPP, TM7LN4, TM7XN1
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for G protein-coupled receptor 56 (GPR56) (Human) antibody (1)

Google Scholar	Find more references for antigen GPR56 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen GPR56 (Bioinformatic Harvester (EMBL))