You are here: Homepage » Product details for "G proteincoupled receptor 62 GPR62 Human"

Product details for G protein-coupled receptor 62 (GPR62) (Human) antibody

Print Version

G protein-coupled receptor 62 (GPR62) (Human) antibody

Overview


	Antigen:	G protein-coupled receptor 62 (GPR62)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN173108
	Availability:	Delivery in 7 to 10 days

Antigen	G protein-coupled receptor 62 (GPR62)
Gene ID	118442
Immunogen	GPR62 (NP_543141, 314 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS *
Reactivity	Human
Antibody Type	Polyclonal
Description	G protein-coupled receptor 62 G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. Mouse polyclonal antibody raised against a partial recombinant GPR62. Synonyms: GPCR8, KPG_005, MGC26943
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (32.16 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (32.16 KDa) .

Image for G protein-coupled receptor 62 (GPR62) (Human) antibody (1)

Google Scholar	Find more references for antigen GPR62 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen GPR62 (Bioinformatic Harvester (EMBL))