Product details for G protein-coupled receptor 89 (GPR89) (Human) antibody
G protein-coupled receptor 89 (GPR89) (Human) antibody
Overview
|
|
| Antigen: | G protein-coupled receptor 89 (GPR89) |
| Antibody Type: | Monoclonal |
| Application: | ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN168939 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: G protein-coupled receptor 89 (GPR89) (Human) antibody
| Antigen | G protein-coupled receptor 89 (GPR89) |
| Gene ID | 51463 |
| Immunogen | GPR89 (AAH03187, 175 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWG MIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2b Kappa »Matching secondary antibodies |
| Description | G protein-coupled receptor 89 Mouse monoclonal antibody raised against a partial recombinant GPR89. Synonyms: AL844549.1, SH120 |
| Clone | 4D8 |
| Host | Mouse |
Application Details: G protein-coupled receptor 89 (GPR89) (Human) antibody
| Application | ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 1x PBS, pH 7.2 |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: G protein-coupled receptor 89 (GPR89) (Human) antibody
|
The detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody. |








