You are here: Homepage » Product details for "H2A histone family member B3 H2AFB3 Human"

Product details for H2A histone family, member B3 (H2AFB3) (Human) antibody

Print Version

H2A histone family, member B3 (H2AFB3) (Human) antibody

Overview


	Antigen:	H2A histone family, member B3 (H2AFB3)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN172988
	Availability:	Delivery in 7 to 10 days

Antigen	H2A histone family, member B3 (H2AFB3)
Gene ID	83740
Immunogen	H2AFB3 (NP_542451, 19 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) TCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGN EAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED*
Reactivity	Human
Antibody Type	Polyclonal
Description	H2A histone family, member B3 Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most telomeric copy. Mouse polyclonal antibody raised against a partial recombinant H2AFB3. Synonyms: H2ABBD, H2AFB
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (36.78 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (36.78 KDa) .

Image for H2A histone family, member B3 (H2AFB3) (Human) antibody (1)

Google Scholar	Find more references for antigen H2AFB3 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen H2AFB3 (Bioinformatic Harvester (EMBL))