Product details for  InaD-like (Drosophila) (INADL) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

InaD-like (Drosophila) (INADL) (Human) antibody

Overview

Antigen: InaD-like (Drosophila) (INADL)
Antibody Type: Polyclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171915
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  InaD-like (Drosophila) (INADL) (Human) antibody

back to top ^


Antigen InaD-like (Drosophila) (INADL)
Gene ID 10207
Immunogen INADL (NP_733750, 545 a.a. ~ 652 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) TLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQ PEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRR*
Reactivity Human
Antibody Type Polyclonal
Description InaD-like (Drosophila) This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. Mouse polyclonal antibody raised against a partial recombinant INADL. Synonyms: Cipp, PATJ
Host Mouse

Application Details:  InaD-like (Drosophila) (INADL) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 50% Glycerol
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

External Information:  InaD-like (Drosophila) (INADL) (Human) antibody

back to top ^


Google Scholar Find more references for antigen INADL on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen INADL (Bioinformatic Harvester (EMBL))