You are here: Homepage » Product details for "Nacetylglucosamine kinase NAGK Human"

Product details for N-acetylglucosamine kinase (NAGK) (Human) antibody

Print Version

N-acetylglucosamine kinase (NAGK) (Human) antibody

Overview


	Antigen:	N-acetylglucosamine kinase (NAGK)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN172669
	Availability:	Delivery in 7 to 10 days

Antigen	N-acetylglucosamine kinase (NAGK)
Gene ID	55577
Immunogen	NAGK (NP_060037, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNR AKRKAGVDPLVPLR*
Reactivity	Human
Antibody Type	Polyclonal
Description	N-acetylglucosamine kinase N-acetylglucosamine kinase (NAGK, EC 2.7.1.59) converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. NAGK belongs to the group of N-acetylhexosamine kinases and is a prominent salvage enzyme of amino sugar metabolism in mammals. Mouse polyclonal antibody raised against a partial recombinant NAGK. Synonyms: GNK, HSA242910
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (33.70 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (33.70 KDa) .

Image for N-acetylglucosamine kinase (NAGK) (Human) antibody (1)

Google Scholar	Find more references for antigen NAGK on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen NAGK (Bioinformatic Harvester (EMBL))