Product details for  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucos...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody

Overview

Image for N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody
Antigen: N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN172498
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody

back to top ^


Antigen N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Gene ID 51172
Immunogen NAGPA (NP_057340, 309 a.a. ~ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCG PSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKC*
Reactivity Human
Antibody Type Polyclonal
Description N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase Hydrolases are transported to lysosomes after binding to mannose 6-phosphate receptors in the trans-Golgi network. This gene encodes the enzyme that catalyzes the second step in the formation of the mannose 6-phosphate recognition marker on lysosomal hydrolases. Commonly known as 'uncovering enzyme' or UCE, this enzyme removes N-acetyl-D-glucosamine (GlcNAc) residues from GlcNAc-alpha-P-mannose moieties and thereby produces the recognition marker. This reaction most likely occurs in the trans-Golgi network. This enzyme functions as a homotetramer of two disulfide-linked homodimers. In addition to having an N-terminal signal peptide, the protein's C-terminus contains multiple signals for trafficking it between lysosomes, the plasma membrane, and trans-Golgi network. Mouse polyclonal antibody raised against a partial recombinant NAGPA. Synonyms: APAA, UCE
Host Mouse

Application Details:  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody (1)

External Information:  N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NAGPA on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NAGPA (Bioinformatic Harvester (EMBL))