Product details for  N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB)...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody

Overview

Image for N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
Antigen: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN170699
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody

back to top ^


Antigen N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU)
Gene ID 4669
Immunogen NAGLU (NP_000254, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFD KNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS*
Reactivity Human
Antibody Type Polyclonal
Description N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. Mouse polyclonal antibody raised against a partial recombinant NAGLU. Synonyms: NAG, UFHSD
Host Mouse

Application Details:  N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody (1)

External Information:  N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NAGLU on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NAGLU (Bioinformatic Harvester (EMBL))