Product details for N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB)...
N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
Overview
|
|
| Antigen: | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN170699 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Antigen | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) |
| Gene ID | 4669 |
| Immunogen | NAGLU (NP_000254, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFD KNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) This gene encodes an enzyme that degrades heparan sulfate by hydrolysis of terminal N-acetyl-D-glucosamine residues in N-acetyl-alpha-D-glucosaminides. Defects in this gene are the cause of mucopolysaccharidosis type IIIB (MPS-IIIB), also known as Sanfilippo syndrome B. This disease is characterized by the lysosomal accumulation and urinary excretion of heparan sulfate. Mouse polyclonal antibody raised against a partial recombinant NAGLU. Synonyms: NAG, UFHSD |
| Host | Mouse |
Application Details: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) . |
External Information: N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) (NAGLU) (Human) antibody
| Google Scholar | Find more references for antigen NAGLU on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen NAGLU (Bioinformatic Harvester (EMBL)) |








