Product details for  N-acetylglutamate synthase (NAGS) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acetylglutamate synthase (NAGS) (Human) antibody

Overview

Image for N-acetylglutamate synthase (NAGS) (Human) antibody
Antigen: N-acetylglutamate synthase (NAGS)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN173184
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  N-acetylglutamate synthase (NAGS) (Human) antibody

back to top ^


Antigen N-acetylglutamate synthase (NAGS)
Gene ID 162417
Immunogen NAGS (NP_694551, 435 a.a. ~ 533 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHS DGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDP*
Reactivity Human
Antibody Type Polyclonal
Description N-acetylglutamate synthase The N-acetylglutamate synthase gene encodes a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. This gene may regulate ureagenesis by altering NAG availability and, thereby, CPSI activity. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia. Mouse polyclonal antibody raised against a partial recombinant NAGS. Synonyms: AGAS, ARGA, MGC133025
Host Mouse

Application Details:  N-acetylglutamate synthase (NAGS) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acetylglutamate synthase (NAGS) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.89 KDa) .

Image for N-acetylglutamate synthase (NAGS) (Human) antibody (1)

External Information:  N-acetylglutamate synthase (NAGS) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NAGS on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NAGS (Bioinformatic Harvester (EMBL))