Product details for  N-acetyltransferase 1 (arylamine N-acetyltransferase) (NA...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody

Overview

Image for N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody
Antigen: N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN169713
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody

back to top ^


Antigen N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1)
Gene ID 9
Immunogen NAT1 (NP_000653, 201 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEF KTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI*
Reactivity Human
Antibody Type Polyclonal
Description N-acetyltransferase 1 (arylamine N-acetyltransferase) Mouse polyclonal antibody raised against a partial recombinant NAT1. Synonyms: AAC1
Host Mouse

Application Details:  N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.01 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.01 KDa) .

Image for N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody (1)

External Information:  N-acetyltransferase 1 (arylamine N-acetyltransferase) (NAT1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NAT1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NAT1 (Bioinformatic Harvester (EMBL))