BASKET
HELP
Product details for N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASA...
N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) (Human) antibody
Overview
|
|
| Antigen: | N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) |
| Antibody Type: | Monoclonal |
| Application: | Immunohistochemistry (IHC), Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165678 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) (Human) antibody
| Antigen | N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) |
| Gene ID | 427 |
| Immunogen | ASAH1 (NP_808592, 25 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNS LKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG3 Kappa »Matching secondary antibodies |
| Description | N-acylsphingosine amidohydrolase (acid ceramidase) 1 This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Two transcript variants encoding distinct isoforms have been identified for this gene. Mouse monoclonal antibody raised against a partial recombinant ASAH1. Synonyms: AC, ASAH, FLJ21558, FLJ22079, PHP, PHP32 |
| Clone | 2C9 |
| Host | Mouse |
Application Details: N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) (Human) antibody
| Application | Immunohistochemistry (IHC), Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
Immunoperoxidase of monoclonal antibody to ASAH1 (H00000427-M01) on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
