Product details for N-acylsphingosine amidohydrolase (acid ceramidase)-like (...
N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
Overview
|
|
| Antigen: | N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN168780 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
| Antigen | N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) |
| Gene ID | 27163 |
| Immunogen | ASAHL (NP_055250, 36 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERF LPQPFTGEIRGMCD* |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | N-acylsphingosine amidohydrolase (acid ceramidase)-like This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant ASAHL. Synonyms: NAAA |
| Clone | 5000 |
| Host | Mouse |
Application Details: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (33.70 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
|
Western Blot detection against Immunogen (33.70 KDa) .
The detection limit for recombinant GST tagged ASAHL is approximately 0.3ng/ml as a capture antibody. |
External Information: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
| Google Scholar | Find more references for clone 5000 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen ASAHL (Bioinformatic Harvester (EMBL)) |








