Product details for  N-acylsphingosine amidohydrolase (acid ceramidase)-like (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody

Overview

Image for N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody
Antigen: N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN168780
Availability: Delivery in 7 to 10 days

Additional Information:  N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody

back to top ^


Antigen N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL)
Gene ID 27163
Immunogen ASAHL (NP_055250, 36 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKWVHVLIGKVVLELERF LPQPFTGEIRGMCD*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description N-acylsphingosine amidohydrolase (acid ceramidase)-like This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. Mouse monoclonal antibody raised against a partial recombinant ASAHL. Synonyms: NAAA
Clone 5000
Host Mouse

Application Details:  N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (33.70 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody

back to top ^


Western Blot detection against Immunogen (33.70 KDa) .

Image for N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody (1)

The detection limit for recombinant GST tagged ASAHL is approximately 0.3ng/ml as a capture antibody.

Image for N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody (2)

External Information:  N-acylsphingosine amidohydrolase (acid ceramidase)-like (ASAHL) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ASAHL (Bioinformatic Harvester (EMBL))