Product details for  N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody

Overview

Image for N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
Antigen: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN168070
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody

back to top ^


Antigen N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3)
Gene ID 9348
Immunogen NDST3 (NP_004775, 162 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLP GTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 Mouse monoclonal antibody raised against a partial recombinant NDST3. Synonyms: MGC130028, MGC130029
Clone 5B9
Host Mouse

Application Details:  N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.89 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.89 KDa) .

Image for N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody (1)

The detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody.

Image for N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody (2)

External Information:  N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5B9 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NDST3 (Bioinformatic Harvester (EMBL))