Product details for N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3...
N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
Overview
|
|
| Antigen: | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN168070 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Antigen | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) |
| Gene ID | 9348 |
| Immunogen | NDST3 (NP_004775, 162 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IGFHKTSEKSVQSFQLKGFPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLP GTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIH* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 Mouse monoclonal antibody raised against a partial recombinant NDST3. Synonyms: MGC130028, MGC130029 |
| Clone | 5B9 |
| Host | Mouse |
Application Details: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.89 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 (NDST3) (Human) antibody
|
Western Blot detection against Immunogen (36.89 KDa) .
The detection limit for recombinant GST tagged NDST3 is approximately 1ng/ml as a capture antibody. |








