BASKET
HELP
Product details for NACHT, leucine rich repeat and PYD containing 12 (NALP12)...
NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
Overview
|
|
| Antigen: | NACHT, leucine rich repeat and PYD containing 12 (NALP12) |
| Antibody Type: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10 dry ice fee and VAT) |
| Order number: | ABIN169494 |
| Availability: | Delivery in 7 to 10 days |
on this page
Customer Service
Additional Information: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
| Antigen | NACHT, leucine rich repeat and PYD containing 12 (NALP12) |
| Gene ID | 91662 |
| Immunogen | NALP12 (AAH28069, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLRTAGRDGLCRLSTYLEELEAVELKKFKLYLGTATELGEGKIPWGSMEKAGPLE MAQLLITHFGPEEAWRLALSTFERINRKDLWERGQREDLVRDTPPGGPSSLGNQS |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | NACHT, leucine rich repeat and PYD containing 12 NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP12, have an N-terminal pyrin (MEFV, MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1, MIM 147678) via their involvement in multiprotein complexes called inflammasomes (Tschopp et al., 2003). Mouse monoclonal antibody raised against a partial recombinant NALP12. Synonyms: PYPAF7, RNO2 |
| Clone | 3B5 |
| Host | Mouse |
Application Details: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.10 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: NACHT, leucine rich repeat and PYD containing 12 (NALP12) (Human) antibody
|
Western Blot detection against Immunogen (35.10 KDa) .
The detection limit for recombinant GST tagged NALP12 is approximately 0.3ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
