Product details for  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7....
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody

Overview

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody
Antigen: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1)
Antibody Type: Monoclonal
Application: ELISA, Western Blotting (WB)
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN166888
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody

back to top ^


Antigen NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1)
Gene ID 4694
Immunogen NDUFA1 (AAH00266, 24 a.a. ~ 71 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRIS GVDRYYVSKGLENID*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 kappa »Matching secondary antibodies
Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the hydrophobic protein (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. Mouse monoclonal antibody raised against a full length recombinant NDUFA1. Synonyms: CI-MWFE, MWFE, ZNF183
Clone 3B9-1A1
Host Mouse

Application Details:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody

back to top ^


Application ELISA, Western Blotting (WB)
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (31.28 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (31.28 KDa) .

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody (1)

The detection limit for recombinant GST tagged NDUFA1 is approximately 0.1ng/ml as a capture antibody.

Image for NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody (2)

External Information:  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa (NDUFA1) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3B9-1A1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NDUFA1 (Bioinformatic Harvester (EMBL))