Product details for  NK3 transcription factor related, locus 1 (Drosophila) (N...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody

Overview

Image for NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
Antigen: NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170741
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody

back to top ^


Antigen NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1)
Gene ID 4824
Immunogen NKX3-1 (NP_006158, 100 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPER AHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS *
Reactivity Human
Antibody Type Polyclonal
Description NK3 transcription factor related, locus 1 (Drosophila) The homeodomain-containing transcription factor NKX3A is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3A protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia. Mouse polyclonal antibody raised against a partial recombinant NKX3-1. Synonyms: NKX3.1, NKX3A
Host Mouse

Application Details:  NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (38.21 KDa) .

Image for NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody (1)

External Information:  NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NKX3-1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NKX3-1 (Bioinformatic Harvester (EMBL))