Product details for NK3 transcription factor related, locus 1 (Drosophila) (N...
NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
Overview
|
|
| Antigen: | NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN170741 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
| Antigen | NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) |
| Gene ID | 4824 |
| Immunogen | NKX3-1 (NP_006158, 100 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPER AHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | NK3 transcription factor related, locus 1 (Drosophila) The homeodomain-containing transcription factor NKX3A is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3A protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia. Mouse polyclonal antibody raised against a partial recombinant NKX3-1. Synonyms: NKX3.1, NKX3A |
| Host | Mouse |
Application Details: NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: NK3 transcription factor related, locus 1 (Drosophila) (NKX3-1) (Human) antibody
| Google Scholar | Find more references for antigen NKX3-1 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen NKX3-1 (Bioinformatic Harvester (EMBL)) |








