Product details for RAB15, member RAS onocogene family (RAB15) (Human) antibody
RAB15, member RAS onocogene family (RAB15) (Human) antibody
Overview
|
|
| Antigen: | RAB15, member RAS onocogene family (RAB15) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169703 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: RAB15, member RAS onocogene family (RAB15) (Human) antibody
| Antigen | RAB15, member RAS onocogene family (RAB15) |
| Gene ID | 376267 |
| Immunogen | RAB15 (AAH40679, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGT HQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | RAB15, member RAS onocogene family Mouse monoclonal antibody raised against a partial recombinant RAB15. |
| Clone | 1G12 |
| Host | Mouse |
Application Details: RAB15, member RAS onocogene family (RAB15) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.10 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: RAB15, member RAS onocogene family (RAB15) (Human) antibody
|
Western Blot detection against Immunogen (38.10 KDa) . |
External Information: RAB15, member RAS onocogene family (RAB15) (Human) antibody
| Google Scholar | Find more references for clone 1G12 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen RAB15 (Bioinformatic Harvester (EMBL)) |








