BASKET
HELP
Product details for RAB27A, member RAS oncogene family (RAB27A) (Human) antibody
RAB27A, member RAS oncogene family (RAB27A) (Human) antibody
Overview
|
|
| Antigen: | RAB27A, member RAS oncogene family (RAB27A) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN167247 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: RAB27A, member RAS oncogene family (RAB27A) (Human) antibody
| Antigen | RAB27A, member RAS oncogene family (RAB27A) |
| Gene ID | 5873 |
| Immunogen | RAB27A (NP_004571, 122 a.a. ~ 222 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEM LLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | RAB27A, member RAS oncogene family The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. Mouse monoclonal antibody raised against a partial recombinant RAB27A. Synonyms: GS2, HsT18676, MGC117246, RAB27, RAM |
| Clone | 1G7 |
| Host | Mouse |
Application Details: RAB27A, member RAS oncogene family (RAB27A) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: RAB27A, member RAS oncogene family (RAB27A) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) .
Immunoperoxidase of monoclonal antibody to RAB27A (H00005873-M02) on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged RAB27A is approximately 0.03ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
