Product details for RAB31, member RAS oncogene family (RAB31) (Human) antibody
RAB31, member RAS oncogene family (RAB31) (Human) antibody
Overview
|
|
| Antigen: | RAB31, member RAS oncogene family (RAB31) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN168475 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: RAB31, member RAS oncogene family (RAB31) (Human) antibody
| Antigen | RAB31, member RAS oncogene family (RAB31) |
| Gene ID | 11031 |
| Immunogen | RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSA KNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | RAB31, member RAS oncogene family Mouse monoclonal antibody raised against a partial recombinant RAB31. Synonyms: Rab22B |
| Clone | 1C6 |
| Host | Mouse |
Application Details: RAB31, member RAS oncogene family (RAB31) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Publications: RAB31, member RAS oncogene family (RAB31) (Human) antibody
| Publications |
Lodhi, Chiang, Chang et al.: "Gapex-5, a Rab31 guanine nucleotide exchange factor that regulates Glut4 trafficking in adipocytes." In: Cell metabolism , Vol. 5, Issue 1, pp. 59-72, 2006/01 (PubMed) |
Images: RAB31, member RAS oncogene family (RAB31) (Human) antibody
|
Western Blot detection against Immunogen (37.00 KDa) . |








