You are here: Homepage » Product details for "RAB32 member RAS oncogene family RAB32 Human"

Product details for RAB32, member RAS oncogene family (RAB32) (Human) antibody

Print Version

RAB32, member RAS oncogene family (RAB32) (Human) antibody

Overview


	Antigen:	RAB32, member RAS oncogene family (RAB32)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN172095
	Availability:	Delivery in 7 to 10 days

Antigen	RAB32, member RAS oncogene family (RAB32)
Gene ID	10981
Immunogen	RAB32 (NP_006825, 136 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVE KILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC*
Reactivity	Human
Antibody Type	Polyclonal
Description	RAB32, member RAS oncogene family Mouse polyclonal antibody raised against a partial recombinant RAB32.
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (36.01 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (36.01 KDa) .

Image for RAB32, member RAS oncogene family (RAB32) (Human) antibody (1)

Google Scholar	Find more references for antigen RAB32 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen RAB32 (Bioinformatic Harvester (EMBL))