Product details for  RAB40C, member RAS oncogene family (RAB40C) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

RAB40C, member RAS oncogene family (RAB40C) (Human) antibody

Overview

Image for RAB40C, member RAS oncogene family (RAB40C) (Human) antibody
Antigen: RAB40C, member RAS oncogene family (RAB40C)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172815
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  RAB40C, member RAS oncogene family (RAB40C) (Human) antibody

back to top ^


Antigen RAB40C, member RAS oncogene family (RAB40C)
Gene ID 57799
Immunogen RAB40C (NP_066991, 150 a.a. ~ 248 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCT PVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGA*
Reactivity Human
Antibody Type Polyclonal
Description RAB40C, member RAS oncogene family Mouse polyclonal antibody raised against a partial recombinant RAB40C. Synonyms: RARL, RASL8C
Host Mouse

Application Details:  RAB40C, member RAS oncogene family (RAB40C) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  RAB40C, member RAS oncogene family (RAB40C) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.89 KDa) .

Image for RAB40C, member RAS oncogene family (RAB40C) (Human) antibody (1)

External Information:  RAB40C, member RAS oncogene family (RAB40C) (Human) antibody

back to top ^


Google Scholar Find more references for antigen RAB40C on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen RAB40C (Bioinformatic Harvester (EMBL))