You are here: Homepage » Product details for "RAB42 member RAS homolog family RAB42 Human"

Product details for RAB42, member RAS homolog family (RAB42) (Human) antibody

Print Version

RAB42, member RAS homolog family (RAB42) (Human) antibody

Overview


	Antigen:	RAB42, member RAS homolog family (RAB42)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN169548
	Availability:	Delivery in 7 to 10 days

Antigen	RAB42, member RAS homolog family (RAB42)
Gene ID	115273
Immunogen	RAB42 (NP_689517, 46 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHS GPCQC*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	RAB42, member RAS homolog family Mouse monoclonal antibody raised against a partial recombinant RAB42. Synonyms: MGC45806, RP4-669K10.6
Clone	3A2
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.34 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (32.34 KDa) .

Image for RAB42, member RAS homolog family (RAB42) (Human) antibody (1)

Google Scholar	Find more references for clone 3A2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen RAB42 (Bioinformatic Harvester (EMBL))