You are here: Homepage » Product details for "RAB5A member RAS oncogene family RAB5A Human"

Product details for RAB5A, member RAS oncogene family (RAB5A) (Human) antibody

Print Version

RAB5A, member RAS oncogene family (RAB5A) (Human) antibody

Overview


	Antigen:	RAB5A, member RAS oncogene family (RAB5A)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human, Mouse (Murine), Rat
	Host:	Mouse
	Quantity:	100 µg
	Price:	326,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN167245
	Availability:	Delivery in 7 to 10 days

Antigen	RAB5A, member RAS oncogene family (RAB5A)
Gene ID	5868
Immunogen	RAB5A (AAH01267, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNV NEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Reactivity	Human, Mouse (Murine), Rat
Antibody Type	Monoclonal
Isotype	IgM Kappa »Matching secondary antibodies
Description	RAB5A, member RAS oncogene family Mouse monoclonal antibody raised against a partial recombinant RAB5A. Synonyms: RAB5
Clone	5D1
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for RAB5A, member RAS oncogene family (RAB5A) (Human) antibody (1)

Google Scholar	Find more references for clone 5D1 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen RAB5A (Bioinformatic Harvester (EMBL))