Product details for  RAB6A, member RAS oncogene family (RAB6A) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

RAB6A, member RAS oncogene family (RAB6A) (Human) antibody

Overview

Image for RAB6A, member RAS oncogene family (RAB6A) (Human) antibody
Antigen: RAB6A, member RAS oncogene family (RAB6A)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN167246
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  RAB6A, member RAS oncogene family (RAB6A) (Human) antibody

back to top ^


Antigen RAB6A, member RAS oncogene family (RAB6A)
Gene ID 5870
Immunogen RAB6A (AAH03617, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNV KQLFRRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG2b Kappa »Matching secondary antibodies
Description RAB6A, member RAS oncogene family Mouse monoclonal antibody raised against a partial recombinant RAB6A. Synonyms: RAB6, RAB6A', RAB6B
Clone 3G3
Host Mouse

Application Details:  RAB6A, member RAS oncogene family (RAB6A) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  RAB6A, member RAS oncogene family (RAB6A) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for RAB6A, member RAS oncogene family (RAB6A) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to RAB6A (H00005870-M01) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Image for RAB6A, member RAS oncogene family (RAB6A) (Human) antibody (2)

The detection limit for recombinant GST tagged RAB6A is approximately 1ng/ml as a capture antibody.

Image for RAB6A, member RAS oncogene family (RAB6A) (Human) antibody (3)

External Information:  RAB6A, member RAS oncogene family (RAB6A) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3G3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen RAB6A (Bioinformatic Harvester (EMBL))