Product details for  RNA binding motif, single stranded interacting protein 2 ...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody

Overview

Image for RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody
Antigen: RNA binding motif, single stranded interacting protein 2 (RBMS2)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN167275
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody

back to top ^


Antigen RNA binding motif, single stranded interacting protein 2 (RBMS2)
Gene ID 5939
Immunogen RBMS2 (NP_002889, 308 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) HHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAAAM QGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFN*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2b Kappa »Matching secondary antibodies
Description RNA binding motif, single stranded interacting protein 2 The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. The RBMS proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. This protein was isolated by phenotypic complementation of cdc2 and cdc13 mutants of yeast and is thought to suppress cdc2 and cdc13 mutants through the induction of translation of cdc2. Mouse monoclonal antibody raised against a partial recombinant RBMS2. Synonyms: SCR3
Clone 3B12
Host Mouse

Application Details:  RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody (1)

External Information:  RNA binding motif, single stranded interacting protein 2 (RBMS2) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3B12 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen RBMS2 (Bioinformatic Harvester (EMBL))