Produktdetails für RNA binding motif protein 14 (RBM14) (Human) antibody
RNA binding motif protein 14 (RBM14) (Human) antibody
Übersicht
|
|
| Antigen: | RNA binding motif protein 14 (RBM14) |
| Antikörper-Typ: | Monoklonal |
| Applikation: | Western Blotting (WB), ELISA |
| Reaktivität: | Human |
| Wirt: | Mouse |
| Menge: | |
| Preis: | 396,00 € (Zzgl. Versandkosten , €10.00 Trockeneispauschale sowie MWSt) |
| Bestellnummer: | ABIN168351 |
| Verfügbarkeit: | Delivery in 7 to 10 days |
Produktbeschreibung: RNA binding motif protein 14 (RBM14) (Human) antibody
| Antigen | RNA binding motif protein 14 (RBM14) |
| Gen-ID | 10432 |
| Immunogen | RBM14 (AAH00488, 51 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRV IECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQ |
| Reaktivität | Human |
| Antikörper-Typ | Monoklonal |
| Isotyp | IgG2a Kappa »Passende Sekundärantikörper |
| Beschreibung | RNA binding motif protein 14 Mouse monoclonal antibody raised against a partial recombinant RBM14. Synonyms: COAA, DKFZp779J0927, SIP, SYTIP1 |
| Klon | 40 |
| Wirt | Mouse |
Anwendungen: RNA binding motif protein 14 (RBM14) (Human) antibody
| Applikation | Western Blotting (WB), ELISA |
| Applikationshinweise | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.10 KDa) . |
| Lagerung | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Beschränkungen | For Research Use only |
Bilder: RNA binding motif protein 14 (RBM14) (Human) antibody
|
Western Blot detection against Immunogen (35.10 KDa) . |








