You are here: Homepage » Product details for "RNA binding motif protein 9 RBM9 Human"

Product details for RNA binding motif protein 9 (RBM9) (Human) antibody

Print Version

RNA binding motif protein 9 (RBM9) (Human) antibody

Overview


	Antigen:	RNA binding motif protein 9 (RBM9)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
	Reactivity:	Human, Mouse (Murine), Rat
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN168654
	Availability:	Delivery in 7 to 10 days

Antigen	RNA binding motif protein 9 (RBM9)
Gene ID	23543
Immunogen	RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTG EHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS
Reactivity	Human, Mouse (Murine), Rat
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	RNA binding motif protein 9 Mouse monoclonal antibody raised against a partial recombinant RBM9. Synonyms: HRNBP2, RTA
Clone	4G3
Host	Mouse

Application	Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.00 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (34.00 KDa) .

Image for RNA binding motif protein 9 (RBM9) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to RBM9 (H00023543-M01) on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Image for RNA binding motif protein 9 (RBM9) (Human) antibody (2)

The detection limit for recombinant GST tagged RBM9 is approximately 0.1ng/ml as a capture antibody.

Image for RNA binding motif protein 9 (RBM9) (Human) antibody (3)

Google Scholar	Find more references for clone 4G3 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen RBM9 (Bioinformatic Harvester (EMBL))