Product details for RNA binding motif protein 9 (RBM9) (Human) antibody
RNA binding motif protein 9 (RBM9) (Human) antibody
Overview
|
|
| Antigen: | RNA binding motif protein 9 (RBM9) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Reactivity: | Human, Mouse (Murine), Rat |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN168654 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: RNA binding motif protein 9 (RBM9) (Human) antibody
| Antigen | RNA binding motif protein 9 (RBM9) |
| Gene ID | 23543 |
| Immunogen | RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTG EHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS |
| Reactivity | Human, Mouse (Murine), Rat |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | RNA binding motif protein 9 Mouse monoclonal antibody raised against a partial recombinant RBM9. Synonyms: HRNBP2, RTA |
| Clone | 4G3 |
| Host | Mouse |
Application Details: RNA binding motif protein 9 (RBM9) (Human) antibody
| Application | Western Blotting (WB), Immunohistochemistry (IHC), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (34.00 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: RNA binding motif protein 9 (RBM9) (Human) antibody
|
Western Blot detection against Immunogen (34.00 KDa) .
Immunoperoxidase of monoclonal antibody to RBM9 (H00023543-M01) on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
The detection limit for recombinant GST tagged RBM9 is approximately 0.1ng/ml as a capture antibody. |








