Product details for  U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2A...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody

Overview

Image for U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody
Antigen: U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN173202
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody

back to top ^


Antigen U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3)
Gene ID 199746
Immunogen U2AF1L3 (NP_659424, 103 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLIT GMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSI*
Reactivity Human
Antibody Type Polyclonal
Description U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 Mouse polyclonal antibody raised against a partial recombinant U2AF1L3. Synonyms: FLJ35525, MGC33901, U2AF1-RS3, U2AF1L3V1, U2AF1RS3
Host Mouse

Application Details:  U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody (1)

External Information:  U2(RNU2) small nuclear RNA auxiliary factor 1-like 3 (U2AF1L3) (Human) antibody

back to top ^


Google Scholar Find more references for antigen U2AF1L3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen U2AF1L3 (Bioinformatic Harvester (EMBL))