Product details for  a disintegrin and metalloproteinase domain 33 (ADAM33) (H...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody

Overview

Image for a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody
Antigen: A disintegrin and metalloproteinase domain 33 (ADAM33)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN172946
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody

back to top ^


Antigen A disintegrin and metalloproteinase domain 33 (ADAM33)
Gene ID 80332
Immunogen ADAM33 (NP_079496, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVT CRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL*
Reactivity Human
Antibody Type Polyclonal
Description ADAM metallopeptidase domain 33 This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Mouse polyclonal antibody raised against a partial recombinant ADAM33. Synonyms: DJ964F7.1, DKFZp434K0521, FLJ35308, FLJ36751, MGC71889
Host Mouse

Application Details:  a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody (1)

External Information:  a disintegrin and metalloproteinase domain 33 (ADAM33) (Human) antibody

back to top ^


Google Scholar Find more references for antigen ADAM33 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ADAM33 (Bioinformatic Harvester (EMBL))